General Information

  • ID:  hor005433
  • Uniprot ID:  P80110
  • Protein name:  Gastrin/cholecystokinin-like peptide
  • Gene name:  NA
  • Organism:  Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Trachemys (genus), Emydidae (family), Testudinoidea (superfamily), Durocryptodira, Cryptodira (suborder), Testudines (order), Testudinata (subclass), Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DLLEALSQDQKLLMAKFLPHIYAELANREGNWHEDAALRPLHDHDYPGWMDF
  • Length:  52(1-52)
  • Propeptide:  DLLEALSQDQKLLMAKFLPHIYAELANREGNWHEDAALRPLHDHDYPGWMDF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May control digestion processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80110-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P80110-F1.pdbhor005433_AF2.pdbhor005433_ESM.pdb

Physical Information

Mass: 704280 Formula: C278H410N74O80S2
Absent amino acids: CTV Common amino acids: L
pI: 4.6 Basic residues: 8
Polar residues: 7 Hydrophobic residues: 20
Hydrophobicity: -58.65 Boman Index: -8992
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 86.54
Instability Index: 5455.19 Extinction Coefficient cystines: 13980
Absorbance 280nm: 274.12

Literature

  • PubMed ID:  1633800
  • Title:  Identification of cholecystokinin/gastrin peptides in frog and turtle. Evidence that cholecystokinin is phylogenetically older than gastrin.